SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|89218|estExt_Genewise1.C_120261 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|89218|estExt_Genewise1.C_120261
Domain Number 1 Region: 1-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.6e-22
Family Ubiquitin-related 0.00041
Further Details:      
 
Domain Number 2 Region: 257-318
Classification Level Classification E-value
Superfamily XPC-binding domain 5.36e-20
Family XPC-binding domain 0.00031
Further Details:      
 
Domain Number 3 Region: 309-376
Classification Level Classification E-value
Superfamily UBA-like 6.99e-16
Family UBA domain 0.001
Further Details:      
 
Domain Number 4 Region: 122-182
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000258
Family UBA domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|89218|estExt_Genewise1.C_120261
Sequence length 379
Sequence
MKITFKDLKQNKFVIEAEPSETIGALKSKIQAEKGWEVPQQKLIYSGKILQDANTVESYN
IEEKGFIVCMVSKPKAAPAASSSRAAPSTPAPAPAQTPSAPQAPTQSSTTHNAPATPSPA
PAQASGERFNDPSALTMGGEREAAIANMESMGFARADIDRAMRAAFFNPDRAVEYLLTGI
PESALQEQAQQTQARAPNSPTPAGGNAGATAQANPSSGGDEPMNLFEAAAAAQNRGGAGG
ARSGGTGGAGGGALNANSLDFLRNNPQFQQLRQVVQQQPQMLEPILQQVGAGNPQLAQMI
ASNPEQFLQLLAEDADEDAPLPPGAQAISVTEEEREAIERLCRLGFERDLVIQAYFACDK
NEELAANFLFDQPDDADDQ
Download sequence
Identical sequences M2SQ63 N4X4Q7
jgi|CocheC5_1|89218|estExt_Genewise1.C_120261 XP_014080544.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]