SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|98631|estExt_Genewise1Plus.C_20256 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|98631|estExt_Genewise1Plus.C_20256
Domain Number 1 Region: 20-332
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.41e-60
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.021
Further Details:      
 
Domain Number 2 Region: 439-655
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.63e-21
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.064
Further Details:      
 
Domain Number 3 Region: 338-434
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000141
Family Rhamnogalacturonase B, RhgB, middle domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|98631|estExt_Genewise1Plus.C_20256
Sequence length 657
Sequence
MRAVTVTVTLSFCANTWAFLKASQNNQSLTIANDRLIASVSKSKGYINVLTLDGQNLLGT
ESGNTGVGPYLDCYCTPSGFWTPGRGKNVQYQLFNGTDSTGTPYGGISMGETYAPTGQRL
EQYWFLKEGETGLHTFSRIVYHNESTPFLRNLQEFRTLFRPNHDPPLFTHFVTNDKFSAP
RPDLNGQVVVQDATWQLANKDDPYVKGVGDYFTKYTFQDSWRNHLAHGMYADGRNTNGTT
FGAWLVHNTVETYFGGPTHSDLVVDGIVYNYMVSNHHGAQTPNITSGFDRTFGPQYFHFN
TRGTLSELHKDAEQYGQRPDWNAAFYDSIARHVPNLITSSSRGTFEANITLPAGAQNPIA
ILTATGHNYQDNAANSTAYQYWTPIPSSGHISIPRVKPGSYRLTLSADSIFGDYTHDTIS
ISPSHTTFASATWTPESAGKELFRIGTPDKSSGEFRHGAVASPTFPLLTEEYRLYWAAYD
FIADFPAGVTFQVGKDDEATALNYVHWSVFGGKANSVRPVPVPDHVYDWTLRFDLEEVVV
SGKKATFTVQLAGAKTAAGNTDLDTGETWANLPLSVSVNGEELEAWVIPYYQSSSCAVRS
AVSCYHLSHKFEFSGDLLKEGKNEIVLGLPYNATGNESALLPEAVYVQYDALRLEVE
Download sequence
Identical sequences M2V8W3 N4Y0Q3
jgi|CocheC5_1|98631|estExt_Genewise1Plus.C_20256 XP_014084936.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]