SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|98778|estExt_Genewise1Plus.C_20406 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|98778|estExt_Genewise1Plus.C_20406
Domain Number 1 Region: 108-414,444-567
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.03e-87
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000496
Further Details:      
 
Domain Number 2 Region: 3-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-22
Family Ubiquitin-related 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|98778|estExt_Genewise1Plus.C_20406
Sequence length 582
Sequence
MASIPVIVKHQGKKHEVEVDTTSNGETFKYQLFSITGVEPERQKVIVKGGQLKDDTDMSK
LGLKPGQTLMMMGTPSGTGVVIEKPKVPTKFLEDMDEAEAAQLEGATPAGLQNLGNTCYM
NSTLQTLRSIPELQEELLRYSASNDAGSSSSAQQLSQFGLGGLGASTDLTSSLRDLFKQM
SETQQGFPPLMFLNALRTAFPQFAQKAKDGHGYAQQDAEEAWSQIVSQLRQKLKVTEKDA
SGADKQTMSWIDKYMSGRFESVMECDEPAAKEGGEEAIHSEDLFFKLNCHINVETNHLRD
GLAAGLKEKIEKRSEVLGRNAMYTKTSKIARLPKHLPVHFVRFDWRRDTNKKAKIMRKVT
FPEELDALEFCTDELRKALVPIRDKIRDVRKEEEDLERARKRQKRMRAGEENDTEPTASK
EPLQKKKEAAEKKEEANKPEDAKMEDIEYKTDAQVEAERIASIVAAKKELLALVDPKMAA
DEGANQTGLYELRGVITHQGASADSGHYTSFVKKQGAKDPVTGKRKEEDGKWWWFNDEKV
SEVDSERIQTLSGGGQSHSALILLYRAVPLPVIEEDVQMGDA
Download sequence
Identical sequences M2TF22 N4XGP0
XP_014084819.1.79200 jgi|CocheC5_1|98778|estExt_Genewise1Plus.C_20406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]