SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|102839|estExt_Genewise1Plus.C_60113 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|102839|estExt_Genewise1Plus.C_60113
Domain Number 1 Region: 160-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000156
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 17-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000181
Family Glutathione S-transferase (GST), N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|102839|estExt_Genewise1Plus.C_60113
Sequence length 243
Sequence
MSSPKVTLFDLPSKQGTAWSLNPWKTRMILNYKSIPYKTEWVEYPDLAPKFKSLGIPPNP
KDAPGYFTDYSSPAIQYEDGTYQMDSWPIAHFLEKQYPNPPLHLDEPIVVKIRDIMKDLM
TPLVPLVLTQVPDVLLNEPSAKYFSETREKKFGKPLHQMRAEADVEKCWAAAAVPAKEMG
DLLREKEGPFFLGETVSYADFIFVTLLQMFNRIDQSVFERYLALDETFPKVFEACKQWMD
KQD
Download sequence
Identical sequences M2UJZ5 N4XIR8
XP_014082377.1.79200 jgi|CocheC5_1|102839|estExt_Genewise1Plus.C_60113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]