SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|109589|estExt_Genewise1Plus.C_150409 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|109589|estExt_Genewise1Plus.C_150409
Domain Number 1 Region: 1-73
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-18
Family Ubiquitin-related 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|109589|estExt_Genewise1Plus.C_150409
Sequence length 77
Sequence
MILVTINDRLGTKTQVPCLPSDPIKLLKAMVAAKIGRPVHEIMLKRQGERPFHDNLTCAD
YAISNGVQIDLELNTGD
Download sequence
Identical sequences M2SM56 M2TLT5 N4X3U6 W6Y278 W6YS90 W7F015
XP_007692996.1.18027 XP_007695253.1.66866 XP_007711854.1.9443 XP_014080259.1.79200 XP_014562130.1.39273 jgi|Cocca1|95005|e_gw1.65.114.1 jgi|Coclu2|54964|fgenesh1_pm.17_#_340 jgi|Cocvi1|84908|e_gw1.2.500.1 jgi|CocheC5_1|109589|estExt_Genewise1Plus.C_150409 jgi|Cocmi1|108708|e_gw1.243.9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]