SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|112999|estExt_Genewise1Plus.C_240094 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|112999|estExt_Genewise1Plus.C_240094
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-35
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 100-152
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 8.24e-20
Family Ribosomal protein S27a 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|112999|estExt_Genewise1Plus.C_240094
Sequence length 154
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKRKKTKLAVLKYYKVDGDGKIERLRRE
CPQPECGAGVFMAAMHNRQYCGKCHLTYVFDEAK
Download sequence
Identical sequences M2T364 M2TVN4 N4WUC3 W6YIC4 W6Z871 W7EJK2
jgi|CocheC5_1|112999|estExt_Genewise1Plus.C_240094 jgi|Cocmi1|88724|e_gw1.28.111.1 XP_007685506.1.18027 XP_007700377.1.66866 XP_007708418.1.9443 XP_014073751.1.79200 XP_014557879.1.39273 jgi|Cocvi1|36742|fgenesh1_pm.31_#_72 jgi|Cocca1|1856|gm1.1856_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]