SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|25454|estExt_fgenesh1_kg.C_70074 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|25454|estExt_fgenesh1_kg.C_70074
Domain Number 1 Region: 98-214
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.57e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 8-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000145
Family Glutathione S-transferase (GST), N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|25454|estExt_fgenesh1_kg.C_70074
Sequence length 239
Sequence
MASPKLVVHHLQVGQGERVTWLLEELNIPYELKLYQRSPLMSPPELKAVYPMGASPVFED
VTDPSNPIKFAESGAISEYILRKYGNGRLALEPQHKNFADYLYWFHFANGTLQPTIFRRS
TTRAMVGEQNPMYTNANAGVTRALEHINNRLLDNTWLAGDDFTAADTMNVWCLTTMRKFE
SVDLSDYQGIQAWLKRVGEREAYRRAMTKTDPDLNLEENLSAKGPQLFEAWAKAMGLKA
Download sequence
Identical sequences M2UWT2 N4X4K2
XP_014081863.1.79200 jgi|CocheC5_1|25454|estExt_fgenesh1_kg.C_70074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]