SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|26078|estExt_fgenesh1_kg.C_160067 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|26078|estExt_fgenesh1_kg.C_160067
Domain Number 1 Region: 149-309
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.67e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.02
Further Details:      
 
Domain Number 2 Region: 20-77,104-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000182
Family Glutathione S-transferase (GST), N-terminal domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|26078|estExt_fgenesh1_kg.C_160067
Sequence length 327
Sequence
MVNPAIHKYGTDDGWHGVIQEGGEFPPEKDRYHLYIGLFCPYAHRANLIRHLFNLQDYLP
ISIVRPYPKGEPGWRFDATYPGSTPDHVFNSQFLHQLYFRDDPAYKGRYTVPMIWDKKSQ
KIVCNESAEMVKWLPAAFSQPSSIATTLYPTDLRDQIDDIKAWLTDLICNGVYKAGFAPS
QAPYEQHVVPLFAALNKLESLLHSNGGPYILGSQITELDLFAYPTIVRFDSVYAQHFKTN
LGLIRHDYPVLNNWLKGLYWNVPGFKETTEFRHIKENYTKSHESINPLAITPLGPYPDVE
EGYEEDWSKLKPGRVVHLRVLEAQSKL
Download sequence
Identical sequences M2VCE2 N4XCD9
jgi|CocheC5_1|26078|estExt_fgenesh1_kg.C_160067 XP_014078095.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]