SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|27266|estExt_fgenesh1_pg.C_20053 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|27266|estExt_fgenesh1_pg.C_20053
Domain Number 1 Region: 14-108
Classification Level Classification E-value
Superfamily PH domain-like 4.57e-22
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0066
Further Details:      
 
Domain Number 2 Region: 167-268
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000929
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|27266|estExt_fgenesh1_pg.C_20053
Sequence length 612
Sequence
MPSILSDEDKQMVKRTVPKSGNKIHAVAVAKLYIAYPDRHRWTYTGLQGAVVLANDLVGN
TFWLKMVDISDRVFFHTFELEDCLAGLSFADEKEARTFKKKLDDREKNAHKNTKSKPFSA
TVGSSIASTNGKSGGHGHGILGGIFGHRSSSHAAPPAHSIIPPSVTSPVQSSHSNATSAR
SSAIDTTDPSWQPLLKELLAMGITEDQIEENADFIKLYIEQRKAEEKLKDENQRRSRAPP
PPPPPGAPLSPQHTGSTTTSKRGPPPQPPPARRTRHDASANRTSSQSPAPHSPTREATPP
PGPPKPVFRAPPPIAEAGKFANQAPAPPNRARASSNAANPGPPPPPRPPKTPVPDEERSG
GAKFGVPPPFTGNRVPSGPPPPPPSRGPVPPPPPARDIPSAPPPPLPPKTSAAPTPPPIH
NIPPPPPLPPSASRPAPPPPSGAAPVPPPLPPTSNAAPPPPPPPPPPPMPGRSIPPPPPM
PSGGAPPPPPMPNSGAPPPPPLPPMGGPPAPPPPPPPGPAPPGGSSLPKVPAGRDGLLAD
IRGGARLKKVSDSEKKDRSAAAVPGKEPPGGSGGGSTSGGGEAGLANALASALAARKSKV
SHSDDESDKDDW
Download sequence
Identical sequences M2V954 N4Y0Z0
XP_014085016.1.79200 jgi|CocheC5_1|27266|estExt_fgenesh1_pg.C_20053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]