SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|28169|estExt_fgenesh1_pg.C_30415 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|28169|estExt_fgenesh1_pg.C_30415
Domain Number 1 Region: 23-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.17e-27
Family PDI-like 0.0031
Further Details:      
 
Domain Number 2 Region: 139-244
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000289
Family Thioltransferase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|28169|estExt_fgenesh1_pg.C_30415
Sequence length 495
Sequence
MVRTSTLLAATAAMALNARAESMYPKNSAVVSINGMDYDRVIAKSNYTSIVEFYAPWCGH
CKNLKPAYETAAKSLQGIAKVAAVNCDEEMNKPFCGNMGVQGFPTLKIFRPSKKYGKPTI
EEYQGPRSAKGIVETVKDKVPNKVKRVNDKNLDEWLQENKDNAKAILFSEKGVVSATLRA
LAIDFAGIVSVAQIKKAEKAAVEKYGITEYPTLILIPAGSDTPVKHEGKLDKAAMVKFLS
QVAPPNPDCPPPKEKKAKGKKDSKKDSKASSKFSKASAAHKDAEASSAAASATEETVEQS
TESPDPNIKDEDTPNPVVIPEEELKPTIPLIAESAELQSLCLTDQSKTCILALLPKDETA
ETATTAIASLASIHKKYDVSGSHLFPFVSVASTNPLAANLIAELSLGSADQVHLIATNGK
RAWYKKYSGTTFGLQEVEQWVDAIRMGEGKKEKLSDSLLVPGEKPQPKKVKQEDHEQVKI
QVEEVEEGSPEHNEL
Download sequence
Identical sequences M2U7G0 N4WP78
XP_014075124.1.79200 jgi|CocheC5_1|28169|estExt_fgenesh1_pg.C_30415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]