SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|43242|gw1.21.163.1 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|43242|gw1.21.163.1
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.8e-35
Family Ubiquitin-related 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|43242|gw1.21.163.1
Sequence length 78
Sequence
ANMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
YNIQKESTLHLVLRLRGG
Download sequence
Identical sequences M2SKW0
jgi|CocheC5_1|43242|gw1.21.163.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]