SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|8744|fgenesh1_kg.C_scaffold_1000022 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|8744|fgenesh1_kg.C_scaffold_1000022
Domain Number 1 Region: 105-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.82e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 20-100
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.41e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|8744|fgenesh1_kg.C_scaffold_1000022
Sequence length 267
Sequence
MADDQPKGLIANKGIELLTWGTPNGWKASILLEELKEAYGKEYTWQAINISKNTQKEPWF
TKLGPNGRIPVIVDHDQGGFAVQEGLAILSYLTRHYDPEHKFSFSDPLDVSRAEQWMAWQ
HGGLGPMQGQANHFNRFAKDRIPYGMQRYTGETERLLGILDSHLANTDYLVGNKFSIADI
ASFGWCHMARFTGVDLEMFPNLKKWLDRILARPAVQKGLSVPSKSTFGNDAYLQRLKDDK
EFAEKEQQLQEQIKAAKEQYGYKYSSP
Download sequence
Identical sequences N4X8A4
jgi|CocheC5_1|8744|fgenesh1_kg.C_scaffold_1000022 XP_014078627.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]