SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|88866|estExt_Genewise1.C_110657 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|88866|estExt_Genewise1.C_110657
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.34e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0061
Further Details:      
 
Domain Number 2 Region: 94-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000000000313
Family Glutathione S-transferase (GST), C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|88866|estExt_Genewise1.C_110657
Sequence length 242
Sequence
MAHVNGNAPKITLYTNHRCPYAHRAHIVLKELGLPYEEVIIDLDNPREPWYLEINPRGLV
PTINFNGEIVTESAIVSTFLADAYPSHLFPASGSPEAALTRARIGFFVDTWSTKASSYWF
KILIQDSEEEKAKLSQEFIETVSKEVEPLLKDAKPFFGGSEKLTLAEALVAPFIARIYAY
SRRGVLPKSIAADLDALPNFSKWAAAVLKQESVTYVFDEESIISTTVKRLDKMKDKFKAA
SK
Download sequence
Identical sequences M2V009 N4X2Q3
XP_014081168.1.79200 jgi|CocheC5_1|88866|estExt_Genewise1.C_110657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]