SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|90302|estExt_Genewise1.C_140291 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|90302|estExt_Genewise1.C_140291
Domain Number 1 Region: 134-320
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.16e-38
Family Hypothetical protein AT3g04780/F7O18 27 0.00048
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.74e-20
Family Thioltransferase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|90302|estExt_Genewise1.C_140291
Sequence length 337
Sequence
MSGTVEIKSPAQLSSLLSSSRVVVVNFYNEQNLSSQTIAPVYDQLASQLSRPGKVTFTKV
STVQQAQIAQSYNVTNTPTFIIYKNNQQIRKYSGSNPQQLSEAIKTLAAEAENDGKGGSG
FASGSGGSGSGSGAWTGASLPRGYTDVTESVDVRGLDLLNADSDFGTVRTLFETSPPSSL
NKGKGTAASTEGSKDWVESDVDNQLMLYVPFTANVKLHTIHITSCTSSSDDDDDEAPVRP
KTIHVWINRQHNLGFEEAEDIPATQVIELKPSDWDEQTQTAKLELRFVKFQNVYSVVLFV
ADADGDSEKTRIDRIRFVGETGEKREMGKLEKIGHDD
Download sequence
Identical sequences M2UT57 N4X2C1
XP_014079759.1.79200 jgi|CocheC5_1|90302|estExt_Genewise1.C_140291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]