SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|9119|fgenesh1_kg.C_scaffold_2000202 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|9119|fgenesh1_kg.C_scaffold_2000202
Domain Number 1 Region: 169-310
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.24e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.044
Further Details:      
 
Domain Number 2 Region: 34-96,128-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000134
Family Glutathione S-transferase (GST), N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|9119|fgenesh1_kg.C_scaffold_2000202
Sequence length 343
Sequence
MDKAPGRESQGSITDWVKPGDKSGEFKRQTSVFRNWIENTPNAEFPPEKGRYHLYVSYAC
PWAHRTLIVRQLKGLEDFISYNSVHWHMAEKGWRFTSSEEKIPGNTIPDPLHQDYTHLRD
IYFEQNPDYEGRFTVPTLYDRKTNKIVSNESAEIIRMMYTAFDDIIEEKYKKVDLFPKDL
QKDIEEMNEWVYNDINNGVYKSGFATTEEAYTKAVTQLFKSLDRLEESLSESTTPYLLSA
PHVTEADVRLFTTIIRFDPVYVQHFKCNIRDIRSGYPHIHKWLRHLYWDYPAFKDTTNFE
HIKKHYTKSHGQINKFQITPIGPLPDILNKEDEVPSVKAALKK
Download sequence
Identical sequences M2TD52 N4XB83
jgi|CocheC5_1|9119|fgenesh1_kg.C_scaffold_2000202 XP_014084173.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]