SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|124082|fgeneshEH_pg.4061__1 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Emihu1|124082|fgeneshEH_pg.4061__1
Domain Number - Region: 134-197
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0533
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|124082|fgeneshEH_pg.4061__1
Sequence length 205
Sequence
MAASVALLSDGFVTAPAVEEDEEAVPLSQSTQLLQRKKEMAAVQLELDKKKDEFLSRMRR
CTEREEELAERQDAIKEQVRKFDKFLKENDAKRARALRKAGEEAKIREAREAERVALEAE
LLRQRAAQGEIEAALRNLERPEQFLARACEHSDYFEDIEAILRRHEVLEATHADLLARVK
TSEEQTLQRREELHETRKRTQTEAL
Download sequence
Identical sequences R1DSU6
XP_005769979.1.92643 jgi|Emihu1|124082|fgeneshEH_pg.4061__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]