SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|46133|gw1.253.8.1 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|46133|gw1.253.8.1
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.15e-26
Family Pentapeptide repeats 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|46133|gw1.253.8.1
Sequence length 116
Sequence
NFQCEDLAFGDLRGLDMWKANFEGVEMTCAAFDDARLLETTFKDAVAARASFVRAKLDRS
DFDQTVLPHANFSGATLREAKLEQANLRHATFDGADLSRTSFVESDLSHATFFGAV
Download sequence
Identical sequences R1CS91
jgi|Emihu1|46133|gw1.253.8.1 XP_005777926.1.92643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]