SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Emihu1|248458|gm1.66800014 from Emiliania huxleyi CCMP1516

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Emihu1|248458|gm1.66800014
Domain Number 1 Region: 398-515
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000017
Family Beta-galactosidase LacA, domains 4 and 5 0.049
Further Details:      
 
Domain Number 2 Region: 50-183
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000282
Family Ricin B-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Emihu1|248458|gm1.66800014
Sequence length 521
Sequence
MKLKPTIISPVLQHHAAEALAAPLAPTQSLRCVGGKATPPVAPPSTTPPAGPVVSLGHCS
NDDPAHFGTLDGSQQWSLEGGALATEDAMRLRWCLSADSDTEGGANVEESTITPRLIVCA
SGREAQRWGYDSVSRRIELAVQRPCPPKGSSRCKYCLESDSRGGSTALQLAVCGEATAQM
WDVNGRTAAGSLAFLSNPTEPFRRFSTVPAPGVTKCTVEYRGRRYVLLPHSVVLVDTRTG
AGGAVTWEFWQEAIGCPGCARQMEASSPLEQLRLTEDDTVYLWYSTVVSAELLGAFLLPG
EPPCRSDRRYECRTVSVPAGEVSGMGGTIAYAFIDDVATTAATPLTAGNQSRELHILAVA
MGLANGGVGPSSSKGPHTWPLLGEQRRIYTAEGTGGLPHTWFRSWLPRPTVAAGAPQTSF
ALNLSTMNKGVAYVNGFNLGRYWLRRGECKGACAPPVKHGHCYMRWKACGRPTQTLYHVP
TEVLAPVRNLVVLFEETVGTATPRDLAGVSLVALHEHPATD
Download sequence
Identical sequences R1DNQ8
XP_005762758.1.92643 jgi|Emihu1|248458|gm1.66800014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]