SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|44432|estExt_fgenesh1_pg.C_chr_40218 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phatr2|44432|estExt_fgenesh1_pg.C_chr_40218
Domain Number 1 Region: 25-114
Classification Level Classification E-value
Superfamily HMG-box 4.97e-17
Family HMG-box 0.001
Further Details:      
 
Domain Number 2 Region: 371-456
Classification Level Classification E-value
Superfamily HMG-box 0.00000000131
Family HMG-box 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|44432|estExt_fgenesh1_pg.C_chr_40218
Sequence length 659
Sequence
MQSHVNAFSFSASGLNTYGFLNQETDDPKPKRALSAYNIFFKHEREEILKATPTRAEGKP
RRSHGKIGFADLARTIAGRWKTVDVESKAKFIRLASQDKERHAKEMKEWKEKRQKILIPP
ATSLASNATDCFFPRNSFSKMDLHRQEQISIRNLLCNIPRKGENMTTTAMSSHQLQRAIP
QSLQSGAFRTGRSRNVQILYSEEADDIEPLPIDSHVFKSEFESHEQSYSTQDSNSYWSLE
QDDQQYSSYEDEDLWIRTNPTHSIQSATAYMPHQISRWNEQFPLEQNGLRHENTYWIGAY
ILESARFRLSSMKYCPVTYFRFISVKHYRKSTMSSPPNSKHLQTAHYQGIVRENETMSDV
AQCRNEAHKELSRLIRPSSAYNIFFRQERLHILQQAHLSSDEKTPKISQEKIGFAELSRT
IAARWKQATPEVRQKFDELADAEKERNHVVVLEWEQLKMNKKNPQEVFTSEKPRPKPDQL
TNAEDSKFLEDIRKAIAQNTKLLVAMRSAVCCNTRILKFAEWRGFRTKGQRFLSTNEIHC
KGGKLQASRELLGPPRASSRYGVSPNVFDDAYSFPQRNLSSAPLNHQPVTFSSLPSECLG
PNTMTSYNEPYPGSHAACFEPVYRDYVNNTCFPQRPLCLPSRSQQNTPTTNHTKRGSDA
Download sequence
Identical sequences B7FU31
2850.JGI44432 jgi|Phatr2|44432|estExt_fgenesh1_pg.C_chr_40218 XP_002178245.1.39622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]