SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|49937|estExt_fgenesh1_pg.C_chr_250139 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phatr2|49937|estExt_fgenesh1_pg.C_chr_250139
Domain Number 1 Region: 345-397
Classification Level Classification E-value
Superfamily HMG-box 0.000000131
Family HMG-box 0.0023
Further Details:      
 
Domain Number 2 Region: 180-223
Classification Level Classification E-value
Superfamily HMG-box 0.000000327
Family HMG-box 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|49937|estExt_fgenesh1_pg.C_chr_250139
Sequence length 428
Sequence
MQPNYNIGGGDAAHWNGGHGDEKSAMSNGYNGSGGLASFQQQQQQASFQQHQANALGGYG
AGAASQFPMWSQMPSGSDGYAGGGADPFHPYMPQQPTPDMMQQMSGLTNGGYGGGYPGQD
MQQMMFQQMMNSQAFAAQQTGGYGGMPGSNPSMAAYYGLPTQNASSMAHAAASSSASAGL
DRKSSRPKKNKDKPKRPLSAYNLFFKDERLRMLSAIPDKKVEDKEQTSDDDTKKEDDDND
DPKATNEKEDKIKAEKGKADTEKATDAKEDEDTSEDIKADTDKATDVKEDEGNKQDSVNE
ETDSKASLEKNEDKDSSKETKGKEEEKSGTAAKGEDESKNGKRKREPHGKISFEAMAKAI
GASWKAIDPELLDTYKARAAVDMQRYKKEMEEFLIKQRQGLEESRDQLETSVDPMAKMRY
FSTSNTGM
Download sequence
Identical sequences B7GCD4
XP_002184787.1.39622 2850.JGI49937 jgi|Phatr2|49937|estExt_fgenesh1_pg.C_chr_250139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]