SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phatr2|50177|estExt_fgenesh1_pg.C_chr_270106 from Phaeodactylum tricornutumCCAP 1055/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phatr2|50177|estExt_fgenesh1_pg.C_chr_270106
Domain Number 1 Region: 196-339,424-595
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-26
Family Glycosyl hydrolases family 16 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phatr2|50177|estExt_fgenesh1_pg.C_chr_270106
Sequence length 766
Sequence
MVSLQQYTFNIFSPGMCASLKIDDIHNKMLPVIAISLISAATNIRHEKLIKFGFRRTKKF
FSVFDLPEPSKRPRRYLWSNLVLTPKTGPKPVLLSHEMGQLFAQRSLIRLWRFLVCFILN
VLFFPPLAASNWIDPDTPLEARTTQPLDVKIPYTPKPPKKPSPATRRKKTVSPAPTSTPS
PSLSPTPAPTEFPTFTPRTFELVFSDEFNTAHRTFEDGSDPRWTAMNKNDYTNDALHYYS
PDNVRVNEEGELVIHTEAADTDVVGFDDVNRKRTHVTKHFRSAMLQSWNKFCFTGGIIEA
EVILPGQSNVGGLWPAFWLLGNLARHTYVGSSQHIWPWSSVNCTQKSGYAQAISGCDRVA
HYGLATQLGRGAPEMDIFEVQPGNLHANQGTFLKMPVGQPFMSSSFQVAPGRASNRPGPG
EWPGPGQWYEGLMGGRNTSLNILFYGNYNSFLNDVNPARQDYWSDAISYNRQLNADHFQK
PHRYRMEWDVPTESSDGYLNWFLDDELVLAIDGTGIKKAGLGSEISSEPSYIILNTAVSK
QWGFPEQCPATCPCDVFDCHSTEWSELCGFSEGFCDMLLKNKAPEYKVNWIRVYQDPNRP
EQKVGCSTPERPTRRWIDAHADMYKTEEDSQPLKGIATGLGSCNPMDDSERPEACGGSQR
GRCTQGRVCECVSGWTGPHCLSRRGFDSVLYDQPDKIKDVGFVPPKIAPRVLIVGLATLT
VCVLAAMQWKQRFDGWQPIPEIEWKKYEERRITNGRYRLFQHSRSA
Download sequence
Identical sequences jgi|Phatr2|50177|estExt_fgenesh1_pg.C_chr_270106 2850.JGI50177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]