SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Thaps3|36929|e_gw1.12.134.1 from Thalassiosira pseudonana CCMP1335

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thaps3|36929|e_gw1.12.134.1
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000012
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 217-290
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000145
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 3 Region: 82-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000001
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Thaps3|36929|e_gw1.12.134.1
Sequence length 296
Sequence
TAIKLLVSNNSSGCIIGRSGKTISELQADSSTRIKLSQGGDYYPGTQDRVCLIQGSLDNA
RVAVEMILLKLLQVESIVNEFGSVAMPFTIQVLVPTPSCGMLIGRGGSNIKSIKEESGVS
FIQLSQKEQDNNHTANAIMSNTAINTAATTSERIITISGCFESCVKCVLLILEEMASNPE
VSRYMNMTTSYSKVVAAQQSAATAQSSHPPSLSAPTHSIQFGIPESMVGFVLGRRGKTLT
QLQEQSQTRIRLSQRGVFLPGTNQRVLTITGNTAEHVANAQYLINQRLSEKGSSRR
Download sequence
Identical sequences B8CAQ0
XP_002293259.1.2071 jgi|Thaps3|36929|e_gw1.12.134.1 35128.JGI36929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]