SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Thaps3|6068|fgenesh1_pg.C_chr_6000223 from Thalassiosira pseudonana CCMP1335

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thaps3|6068|fgenesh1_pg.C_chr_6000223
Domain Number 1 Region: 648-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 2 Region: 846-919
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Thaps3|6068|fgenesh1_pg.C_chr_6000223
Sequence length 1307
Sequence
MAAASTDASHALVPPTAADIEDNDVDEEDDDDETVVGTCLHCNSPPPPRSARGGGACTFT
GGSSPCPASNPSAVVTSVPSHSDGETRVQVSCDDCRSFICDGCHWCHEFQANHEIRVCDR
CDAFYCRGCDEMDQCEDCSEVVCNTCSTLMSCKFCGCGLCEDCATACGRCGIVLCARDAK
FAVECDTCKMSYCLVCLASGTKDPCVRCGHRPSKRVEQLVHLRLKSIYKAFKQSGASGGS
STGAVPGIISGDGGDAQGDEAVTVTRNGAGRDISTIGGKYSSALRSLTENESLGSSKDNF
GTFDQSMANEVAAVLQTASNAMVSEGGDDRRSRGKRVTSHHSSSSSHDHGSGGNNPSGHG
RDNLHPSTRPKTYASEGYYHRTQAEIVAAAKAAEAEAEAAAAALLAELDEEMAASSKKGK
KKKKKGKKKDPSDDTPGAAVSPDNSGSDGNTATQKKKGASSPQNLPTPQDDESSEDEEMI
LEQLVGITKSSRSSKKGRNEEETEKSAVIAPQLPEPKIEVPAAPMEETPDYENELAVLLS
NDDEEGLEEFLANVRGVPGLSTIRKAAKKALKKMKGDTAFQTVVEPEDVSSKVSSSDVES
TANPSASNMPASTQHEPLLRVVSRTQSAVGAVPSKGATSTLTSVPASARAECVMHMAPKI
VGWVIGKGGQRIRDMMEESGAKIWIDQESMGTNDARVVYVSGKRSAVDAAVRMVKDLVAK
APVPASAPTAQGVAQASTTTTSTASPTPAKSPPSVPSSLPSSTALEPSKEPPSFAAAIAS
KYSSPVAVTPPVPTSSVATKTAAAQSWSSPALAASTPVAPMAPPQPTPPPATTISVQPTG
SLVEGPGNMMAETVTKELLCAPQFAALLVGRNGIVARNIQTESGATFIVNQSVQPPKIII
SGKTEHVKKAELLVRGVLNHQNKQLSSQAVPQQHDGALNNIQPATESKNRHDQNAGDVWR
QHHDRTAVPSAQIRYHKPLDDVLPQQPRRLSNNASSSVEGMVCSKAVINITRLFYSGRLN
LILLQNYPPGYNFQQQSNLGLFQDSRPANTTPDMMQNEHHLAMPGTSVGLRHQEWAHQQK
RYMPPQYPSISSYSNAQINVNEQFLRSNPYPFSTNHPNNVVHTRAPAYPIQPDQHSQIGR
SDGVDDFLLARNVSQNADDGWGLNTNRSIAGETWRQSQNTPVASPNQPTFGAQRSLPLES
TLPVDNLFQNQLHQQPRGNPSGVTTVRDDSQFVDSMFDSLGGSGSEGDSLLNALNSVSLG
GTQQGTWGGGGWGGGESGGNSSSLLHNSRLGGIAFGSTNQNNKRNER
Download sequence
Identical sequences B8C5G8
35128.JGI6068 XP_002291007.1.2071 jgi|Thaps3|6068|fgenesh1_pg.C_chr_6000223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]