SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Thaps3_bd|1798|estExt_fgenesh1_pg.C_bd_8x510016 from Thalassiosira pseudonana CCMP1335

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Thaps3_bd|1798|estExt_fgenesh1_pg.C_bd_8x510016
Domain Number 1 Region: 669-744
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000122
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 
Domain Number 2 Region: 425-490
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000823
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Thaps3_bd|1798|estExt_fgenesh1_pg.C_bd_8x510016
Sequence length 875
Sequence
MANVKVEQADDDDDDATLPPPTQYKLLTPLTPKQLSDFHFPPNCPVSYHHSTTSPNEQRL
TTCDGVIVAADLVLDQCEPQHPKVMCRVDRKTNDGVSTGSTVIVTESVLLSDLAYATHCP
VEVTIEGEIHDGVVAYSVAGVNEAGGRVFKYHILIGGVGSMRIEKDVLAESVRYRKVEVV
GPPMNESKGVLSEGATPTNDEKPEAQTQTTFLKETPRSFEISSRDAAIPTEGEGESAKAK
DARVGANTTEQTKPAAVSNGGRSGGAESNLDENTSASVSKKNISAVIANSNLNESTSASY
ATEQKGSVGIDTSVLNDNSKALVATSKQNDNTIGGGDSNGPEIKEVNGKQWQAPRRFTRS
NSASGTIPPSSSREQTTRLPNVALGDYQTKSLGRNEVIQCRLNVPVWVSRAGNLFLHLVG
TDSTGKNGHKTRNISHETDCRISIDETKSRHDLNQPITVSIISNKRKDAGRNVARARELI
EDSIIDFLPDKRAADRLLNELASSAGGNCHKRVAESCAVMQRTYGTNNFGWKQLLNFPSG
WQRLDIIAGDTKQPLRICDPYIIVSGKELKNVESIAGTVIETMNEIIEQNTGVPSMSTIM
SATSDKSNTAQSAGCRMHFNGALFPNNRQNSGLSLKRDSMSDSGSLHEPPGKKPRRDINE
KVCLLRIPSWLTEDASASLFHHLIGQGGYKTKEIEQKTNCKLRIGRNNEPMTVSITPIER
ESSRMNLAKRMIENSLIEFLNDRNAEVRLMYDLAYCSNDTFPLNRAKSGAVRQRNPLSDE
KVWMHVLELPSITRNDTTEYHGKFLYQGKGSSKQQVKDYDCSMEMFGDDFGAPLRACTPY
VVVYGEKKMQVESCVEMIETVVRRHQERCICKPKW
Download sequence
Identical sequences B8LE63
jgi|Thaps3_bd|1798|estExt_fgenesh1_pg.C_bd_8x510016 35128.JGI1798B XP_002297313.1.2071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]