SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA00747 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA00747
Domain Number - Region: 53-90
Classification Level Classification E-value
Superfamily RING/U-box 0.0041
Family RING finger domain, C3HC4 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA00747   Protein: JA15438   Gene: WBGene00119951
Sequence length 99
Comment JA15438 WBGene00119951 status:Partially_confirmed
Sequence
MVCGDCEKKLTKIVGVDPYRHKKTNRAADGSGPKTVTTKNRLIGVQKKTSIVGVRCKLCK
QLIHQPGSHYCSTCAYQKGICAMCGKKIINTKGLRQSTT
Download sequence
Identical sequences A0A2H2HV33
281687.CJA00747 CJA00747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]