SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA00848 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA00848
Domain Number 1 Region: 746-948
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.67e-69
Family Reverse transcriptase 0.00024
Further Details:      
 
Weak hits

Sequence:  CJA00848
Domain Number - Region: 513-610
Classification Level Classification E-value
Superfamily Acid proteases 0.000269
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Domain Number - Region: 350-406
Classification Level Classification E-value
Superfamily Kinase-associated protein B-like 0.0262
Family Kinase-associated protein B-like 0.017
Further Details:      
 
Domain Number - Region: 470-484
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0377
Family Retrovirus zinc finger-like domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA00848   Protein: JA37164   Gene: WBGene00120052
Sequence length 950
Comment JA37164 WBGene00120052 status:Predicted
Sequence
MDEFMETMDGVVEELVVDERRTGTKAAAATTGESTTGTAEEELLREMDMVSLKVMRKRIK
GFAKFVASATEVEQQTREKIVMMTKCSERQKELILAPVAKFGRELLERFEEMGGDEWPRS
VLRVMREFGVESVEELREACGQAARFREQGDSKDKLKKKLENQNNERILLQEAWKEEEKT
LMEQMKKLEEQKKVAEESVERLKKALKEEKKAAEGLKSNLQHCTGEFENVGEENWEQNIQ
EPYRRRGGACGRSKTSSAKEEEGAEGKRIDDYLGESWRGKVEDWEMESRSSRSSGMKEMV
QCMSRMMKSSALPEPKTFDGSGEFGEFKRAFLLKYQQVTEGDDELVAILEEKFLKGAAKT
LFQSLPKRYERSLKALFEEFEKKLRKRQGDRKAEALNEFEELKKKHGQKMWEYLLEVEKW
SRTAFPEVGDETLSQMRTTKLMKAVREDDTLHKMLIMKRGWSHQLQQEMFRCGGMGHMSR
QCTSKPVQNVKARKEDAVKSVGAEIVEIVEMLGQRRRIVIDSGAVVSVMSTGAWNRLKKG
CPSWEKEVEMLAKPSFTLVDASKMNMPVKEQVKIDIGVRGRRALVVFQLVENEADIFLLG
TNAFESVGVELKWKAERSVAMAAEKLRVPPQSCAQIMVKVEADLGNNVLLESKEEWVPTS
LCSKNENGNLTVLVSNWKDEPLLIKKNHVIGVVTREWELLESKRDKAVNMLDLDRKVPLK
GNRRNDEFWRILVENGEVPDGNIRRIVSEFSDVFAIEESELTQTDMVQCEIELEKENPIR
QKCRPVPLALQEKVKVMLEDMETRKVIRKCRSPWASPVVLVKKKDGSIRMCVDYRKLNTV
IKLNAHPLPHIESTLQALGEKKWFTTLDLMAGYWQIPMEEQSKEKTAFVVLNEQYQFEVM
PFGLATSPAIFQAAMEQVLGDWIGKSVFVYIDDILIASKTEREHAEDLAK
Download sequence
Identical sequences CJA00848 281687.CJA00848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]