SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA01422 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA01422
Domain Number - Region: 35-93
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000768
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA01422   Protein: JA14914   Gene: WBGene00120626
Sequence length 109
Comment JA14914 WBGene00120626 locus:Cjp-unc-69 status:Partially_confirmed
Sequence
MSAEKPEQDDIPLADDDDTVTIISGGKTPRAAQPLPKEEPPEDPEEKARLITQVLELQNT
LDDLSSRVESVKEESLKLRAENQVLGQYIQNLMSSSSVFQSSQPSRPKQ
Download sequence
Identical sequences A0A2H2HW66
281687.CJA01422 CJA01422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]