SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA01549 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA01549
Domain Number 1 Region: 6-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000248
Family First domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 63-109
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000785
Family Second domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA01549   Protein: JA32936   Gene: WBGene00120753
Sequence length 123
Comment JA32936 WBGene00120753 status:Predicted
Sequence
MSRRGSEGEALFRQVTSDLSIEEREYFSFCFYDKKEGIRHWLYNDKKILKQLKNLPQEFS
FEVKFYPTTPTTIVDDHARYYVFLQLRRDILTGRLPATADTHALHGSFVVEMTIKCIKCY
FFF
Download sequence
Identical sequences 281687.CJA01549 CJA01549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]