SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA01773 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA01773
Domain Number 1 Region: 422-575
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.68e-34
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 277-368
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000165
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  CJA01773
Domain Number - Region: 218-254
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000488
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA01773   Protein: JA37615   Gene: WBGene00120977
Sequence length 1267
Comment JA37615 WBGene00120977 status:Predicted
Sequence
MADLSRRIQKYSYTIGEPDSFKRWLTRHEPIFEEDGSELSEREKTRLLLGSLEETTFHRF
VDSQRDVEDIYDVTFKETVAALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTNHIG
QLVADAKLATMTADEWSVFLFFRGLDAPGDAAAKIYLMQFTEMAERKGETITLSQIHDEW
MRFLLIKQQTKIVATSKQNPQTPVEVWKLEASKTKRRENPKFTPKWGSKGRRPPFCDYCK
RAGHYISKCFLKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMITII
NSESWNMIGRPPLERVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVREKNTNLIG
MSWLSQSPLMRKAMDVMVNQIEIPSAGMARLKDNPTVRSGNCQQNTKRTRITSSKPCPDK
KKPWAHIYVDFAGPINGFWFLVVEDSKTKYAEVKLTRKASAAATVDLIEDIFATQGYPDW
IVSDNGTQLSSHLFKKMCESHGITHKTTATYCPRSNGAAERFVDILKRGVSKIKGSASIN
QRVLNNFLINYRNTPHAALNGATPAECHFSRKIRTTRSSPMLAERASENTEWIHYQNKMK
GAYGKQNGVRANTFKVGQKVYARVQHGNKWSWGYGKVRRRVGSVLYEVQVGEKIQRCHAN
QLRQRYGDKGPEELFSDSNFPLFFDSMPAQKTNSPKLIQNQRVSEGLRGETNLLRFPDFS
SFSCNYPELDMVNSGRSPRGVGQGVFGSSPAAHDTSRSDGFGRVNRGNQKMECRSELNEN
QSPNSRTFLERKEEVSSPCTQQLESEVQQDVSRVQPAPNLSQSLRRSQRNRRAPVRYDPC
LELQSHSEDRGEPLDDVVALCMVEHLQKQLISNHSNPMVHKIARAMTNRIVATRSELEFQ
NSSTLLDVSRPDWATNQLTAIALLQGKDIGQLLDLYLEKRFEYIRQLIDDSTTILSIVDE
MKKTLAVVEELFLHGELIHAIHSVCNGQYRCELVRDMCADQAFSFERTINEDMDRVWRHL
REKLSGRGAGTLPAQLVTEKCTAWMEKTCAVTHTLVAEVCEYFDSLDQIIDLLQAITLSL
KQDWPRIGSSRSVYEQLVQNAVVDKAKVLLIQIIESIELSAKKRFESTSDGPPTAIFDER
VYRPDSQAHIGISTQLYKCVKALWESLEQVNEKCAQFETICGPMADQSTANALKETMATN
VLQLLLRLCELHCNASGGASQFLARARLALALIHSESAIVCTLLDKDSQRITSLNQRLHS
IIEQNLG
Download sequence
Identical sequences 281687.CJA01773 CJA01773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]