SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA01796 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA01796
Domain Number 1 Region: 294-728
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-22
Family Reverse transcriptase 0.012
Further Details:      
 
Domain Number 2 Region: 1058-1138,1173-1240
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000000664
Family Retroviral integrase, catalytic domain 0.043
Further Details:      
 
Domain Number 3 Region: 15-89
Classification Level Classification E-value
Superfamily Acid proteases 0.0000113
Family Retroviral protease (retropepsin) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA01796   Protein: JA37095   Gene: WBGene00121000
Sequence length 1631
Comment JA37095 WBGene00121000 status:Predicted
Sequence
MEDTQYRLPFLCLRTKDDQPILALYDTGASLSLMSHKSAERLGLEKVGSTQFTITGFSNT
VSNRANIYKITFKTKNQEIYFCTHIAGCPTLPNTAFSAPTFSFEDERFMNSKGIDYNESA
NSFVYDNQPIDMIIGNDLIAWIQEKSVRVKLPSSRQIELTPFGLLAYPSFRKEAESEEMQ
CHIADAIQFREELETALDSRILEQYEEDSSEQLTKEIAQLWRIENIGISPPSGKDKEESV
DLLNEFLKNLRIRASGHVEVAFPWNGNETRLTDNFQMAFVRLKSTREKLKEKGLEKAYSD
LFKEQLEQNIIEIVNVNTTRESKTRPIYYIPHRVVVKMQSLTTKLRIVYDASSHMRGELS
LNDCLHAGPSILQPIYGILLRSRMKKFVIISDIAKAFHQVRLREEERDVTRFLWIKNVQE
PLTVNNLVTYRFTRIPFGITCSPFILAATIQYFLRNKKVTDGDTAERIEENLYVDNVLFT
TNEENEILPLYKKSKAAFNGMKMNLREFLVNHEESMKLIPEEDSASALSCNLLGYGYDSV
RDVLTVKLTELKESHPTKRQVSSRQGKNFDPLGIVAPATLPFKSLMQEVWEDVIDWNTKI
PEELLPQWNAIKDGWTLKEVEFPRQITNRHDYKSVQLLMFSDASKDFYACVAYLHFEFEN
GPPITNLLTCKSKIKPSNSESFTIPKLELLGIEIAAKVACQIVEELKMPVSNTMFFTDST
IALYWILRNEQKRVWVANRVKEIHARHSVLISQSINPSFHHCPSELNPADLATRGTTMDR
LVASDLWFHGPHFLKEPSETWPCRIEGSITCPEDFRKLVFEEIVETKRKEGKITEKVVKK
AMIPRPERAKQVDLHTVLASPPKSQNPYKSAIVPFEKSNSLKKIISTVYRVFTIIERNLP
NHKFEGPVLKAFTNCEETDYVNRRRIVRWFIILEHYRESESQGFFFPKNLTPFEDTHGLH
RTHRSIESAGTLSKESTSPILIHRKHPLARLIVNETHLTNGHLAERYMVPALRIRYWITG
DTALAHSVVSKCVECKKNQGKAFAYPFSETLPKSRTNLSRPFSQVGLDYIGPIEYRKEDR
TVGKAFILIYTCLMVRGVQLELVPDGRTESYLKALKTIFRSKGVPEAMFSDNAGTFQLGG
KMINDDINSFVHLRSKARVGSEKIRVPAPTPAFTDLLADEEIIFKFITPLSPWQGGVYER
LVGIAKGHLFKAIGRSLVPWFDLHHAVKDVESLMNNRPIMPNPTKAEDLPALRPIDFLLP
SVLVEVPTCPEAIAKGAGEAEKRARAHLAEFENLRTMYHSIWTSAYLLTMLESHHKNKKC
SAMVPKVDQVVMVWEDLTTHRDYNLGRILELIKSPDGKIRKALVRIKGKKFLRSVCHLIP
LEIGDEENRETEDNHDPQGRDRPQFDLPTAAVFPRTPVPPLPIGSSVMHSRELAKQTKIE
TIPNQRVELIERRKYELEEEGLVIPSRKSPAGLIDEGTSNLAQLPEGYEDEENTERETNT
ESDDSDPERNESENTPLTAQTNPKRTRAMLSRKAKSRWINYVCAAEVRGTQRVPEDTPDP
KVNTPSAYSKSYTTREELVEATRVIMLRRPKLRRSYTLPPDRCIFSEPASFQTPPPRSVV
NSPFGMNSQPF
Download sequence
Identical sequences CJA01796 281687.CJA01796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]