SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA02126 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA02126
Domain Number 1 Region: 840-1255
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.78e-118
Family Reverse transcriptase 0.0000685
Further Details:      
 
Domain Number 2 Region: 568-669
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000012
Family Retroviral protease (retropepsin) 0.0078
Further Details:      
 
Domain Number 3 Region: 455-482
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000471
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA02126   Protein: JA38818   Gene: WBGene00121332
Sequence length 1315
Comment JA38818 WBGene00121332 status:Predicted
Sequence
MEHPAHLSCDAVSDKASMTIFRNAVCKDLHVAHERISDVFGTIQVRIEKLEKERATMAFA
DVLPRAELNTPPETHSVKRLADSDSRKLQNLTIIKQPQGNSVSPLGEQVNPHFPDKAEVA
APVSGKSRRNPVANTEESTSEKKSGVASNETPARVVAARSQSCGKAPAGPQEDIIVASQS
NVAPERNAQHPSINVITQSDCQQAAAATNKRGATRSSSPNRRITRAMSASQQPRVNVLAM
KSAASVPIFSGTNKENFHATSKITNGSPENQTTESTKLHSPLANDASAHHCEIAGALEGG
GAVQRVRKLMREAQTGANRSEVIQVAKEAFRTGLQSDIRFYVTTARSTEFDQIYKDAIFF
EKALQYKERKERADAAVIANRPRAAEVFAQAALRHQGQFYDYEDDEQSFYPAVTALNPRS
GNNRPGNHQQRTPGVAFNNPSRDFNMSQNFSRSFDQIRNRNAECWYCGFSGHYRQDCRKR
AADIARGIFRSSIDTPHNAPMHSIRSGNAEPRRTPLNPVENHQQPTIRVLQSTSSMNLPT
PAEAASSQTVPTANTVRQVSTSFITAQVPVRANGRPCHALIDTGANITVTSEATKETFYN
TPLEQPKSSTALGLGGNAVKMVGAAVIKFQIGPFKVDHLTHFTEGRCTPAGPTDYTFIIG
NDVLSQLPQFVFDYANARFLIGGAILPMGNQQERDSRPGNYRLYLEENTTFPAESEQRVK
GTLNKKLTNHDMVVHQQSDLCDRLGLSITPTVFRSQNALLLVTNPTRTDITVPARATIAN
VGRIHTAPDGSLHCSDTASDEAFPNIATTDSRLQPLDPDFKIDFNSIQCKEEERRQLKQL
CEDYADVLSRNPYDLGSSKTDPVHIYTTSEVPVKSRPYRVPVKYQAELEQHINALIRSKR
ITESNTPWTSPIVLVKKKSGALRVCLDFRRLNDITKPDNFPFPSIDAILEKVGGARYFSS
LDMANRYLQLRLDAESSYKCGFITETKRALKTVLANMDRDVLVYIDDILIYSQDFGQHIA
TLRNVFDRFRQFNLKVSPEKCEFLKKAITFLGHTITESNYTPNEANVKSIAEMSTPKNLA
EIRRFVGMVGFFRKFLPNLATVAEPLTRLNRKNEKFRWETPQQEAFDTLREALLDKPILA
FPDYEKPFNLFCDASAVGLGAALMQAETEEEKHFKAIAYTSRTLADSETRWPAIQVELLA
IIFALRHFRPYICLSNIILHSDHRPLSYLLSKHKVNDNLARWLIKLQQYDIKIVHIDGKK
NTVADYLQRMQGEGQPNETELEDIVSFSICMANTTNEHVPPIILDTHIITAVQTX
Download sequence
Identical sequences CJA02126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]