SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA02445 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA02445
Domain Number 1 Region: 141-241
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-21
Family Retroviral integrase, catalytic domain 0.0099
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000445
Family Reverse transcriptase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA02445   Protein: JA32199   Gene: WBGene00121650
Sequence length 374
Comment JA32199 WBGene00121650 status:Predicted
Sequence
MSKITLHTDHRPLVHILAKRKVNERIARWLIEIQQYDITIVHIDGKKNTVADCISRAKDE
IAPLPTEELEDIIEFPVCMAIDRLKDRVPKQFTPASTKKPVDLATEQSKDKDIGIIKRFL
TTTTTPIDGISEKWTPFLERIQLSNTDNASSFTAAAFQQFCNLLDIGHHRAIPHHSKGNG
ATERTFRTFHAVMSKYVNKEHTDWDTILPFTTFSYNNTVHSTTGETPFFMVFGRDPTFTI
DRIIDPTPSARKTDIGWFKESLTTTLRDVWKQAAVHSREAQANYQKKANEGAAGSGIRPG
DRVMYRDFSNHKGLSRKLVLPWTGKYRVVEVNPPKATIYDRQNPKKPERIVHLDQIKKIF
TAADIRPAIQKKIQ
Download sequence
Identical sequences CJA02445 281687.CJA02445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]