SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA02821 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA02821
Domain Number 1 Region: 583-792
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-19
Family Reverse transcriptase 0.022
Further Details:      
 
Domain Number 2 Region: 937-1018,1046-1113
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000000000157
Family Retroviral integrase, catalytic domain 0.034
Further Details:      
 
Domain Number 3 Region: 302-381
Classification Level Classification E-value
Superfamily Acid proteases 0.000015
Family Retroviral protease (retropepsin) 0.053
Further Details:      
 
Weak hits

Sequence:  CJA02821
Domain Number - Region: 169-231
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0102
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA02821   Protein: JA31639   Gene: WBGene00122025
Sequence length 1491
Comment JA31639 WBGene00122025 status:Predicted
Sequence
MNGSTVFDSDQHRSHTRSIHLTDIRSRNEYESDLQATSTPTTSKTILENNVNKSQSPNIH
NSEKFSPEQMIAIANAFKQIQNSGDTSQSSLPQPNQVRRQNENHHQNGNKYQTGRRDPHN
HYRSNSRNNSRPRTPLNEAVLRMNPSYELGPGPIKDKIFLMHPKPFDSRRNCPMCGPGHT
CVSCPAPYQSFRDFLEREQRCTICSSRHPGRKCSSDKLCIACNGRHNTAACSLKAFFSNP
VNYPTDAPKIEPFTFFRVSPGLITHESRNIKLFTSQLKTLQPVVHSITESSPDDTRYRLP
FMCLYTTRGVPLLTLFDTGSSITLIRPESARRLGLEEVSSTNLTIAGFSNTVTSVSKIYK
VSFTLPKSTITLNTLIADTPYLPTTEFLAPSFSPEDEESLRLHHIDVDQIVNTYKHDYKP
IDIILGNDIISWMQKHSKRIVLPSGRVVDITPLGAVAFPSSYSNILPSHCDSTSIHTSFH
SHTTREDLPTPTHRSTTEEEWDISLSEEIAQMWKMENIGINAPSSEEKKETTDLIKEFKN
NLNELESGEIEVAFPWNDNKNRLAHNFNMAFVRLKSNFDRLQEKEMLEQYSAMFSEQLNI
NIIEMVTPEMDRAEGPTYYIPHRAVMKLSSLTTKMRIVYDASSHQRDELSLNQCLHAGPS
ILQPLFGILIRARLTKYIIISDIAKAFHQVRLRKEERNVTRFMWVKDTKKPVTRDNIVVY
RFQRVPFGITSAPFLLAATIYFFLFTRKVTDDPLAARIAENLYVDNVLFTTNDLAEIHSL
YTDSKKAFSKMSMNLREFLINNPAEMNKLPKEDIASAKDCNLLGYKYNSIEDALTIKLVT
LDKPDPSKRQVASYLAKNFDPLGYITPILVPLKTMVRLCWDDGINWNEKLSLNQTVLDIW
KVLRSGWTHSQISIPRQLTTSYNYSSVKLLLFSDASKEPFSQVGLDYFGPIEYRLQTGEI
SKCYVLLYTCFMIRAVHLEPIPDGSTESYLTALRTIFLSRGVPEKIYSDNAGTFQLGAKI
MNDEIRHHVKTQHHGEIRVTAPPPALSIMLSDNCIDTEFITPLSPWKGGIYERMVGITKN
HLFKEIGRSRLNWFYFTHAVKQVEGLLNNRPIMPNPTRAYDLLALRPMDFLLSSALVEIP
TDPDRIVKNAGQAEKRVLAHLAEFDNLRSVLASIWDSGYLLNMLEANHKKKRCSTLLPKV
GQVVMVWENFTDQRDYNLGIIEEVITSKDGEIRTAIVRMRGKLYRRSVCHLIPLEIAFLT
KKEDDTTTNEERHTDEDPDYKSVPPPQAYPGPALFPASTASPIPIGASPRESRTPNPVHR
NDIMEDLFVPTQGRTYELQEDVQPRPPRLNPSGLIDPSTGNLAPLQEGYSDDEELVPHTV
GAEDSQSQCYPGHVKAPPKAFVAPKTNPKRIRPMLSRLAKAGNINYVHITDSEDVFTISY
RRFSLPEKTCVHTCEISEGYASPPECCGFCPRELEPSTFLCFGLNATVYSK
Download sequence
Identical sequences CJA02821 281687.CJA02821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]