SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03010 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03010
Domain Number 1 Region: 107-153
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000106
Family RING finger domain, C3HC4 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03010   Protein: JA19832   Gene: WBGene00122214
Sequence length 178
Comment JA19832 WBGene00122214 status:Predicted
Sequence
MGNDQSRRHPSYRNILLENGEYLTFALRRDSLVRSPNWKAEIPIICCKIHMERKVVLSTK
TLSFVEFLSAYDLHKLIVINKECKQPNVDPMTTSQYIMNQTSDVEGNCVICMENENDLLL
PCLHSFCIRCIVAEMEYRTDFSCPICKTKIQKPIESSWEVPDAPNQEEINEYLKEIGK
Download sequence
Identical sequences 281687.CJA03010 CJA03010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]