SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03079 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03079
Domain Number 1 Region: 231-391
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-37
Family Retroviral integrase, catalytic domain 0.025
Further Details:      
 
Domain Number 2 Region: 2-55
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000296
Family DNA polymerase I 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03079   Protein: JA35056   Gene: WBGene00122283
Sequence length 412
Comment JA35056 WBGene00122283 status:Predicted
Sequence
MIFALKRFKAIVYGTQIIIMTDHKPLLALLKGTHLADRLLRWSIELLEYNVKIVYLSGKA
NVVADMTETSDEGTKELLRIVNALQEKSDDTEVMNQENWLNHLKNSDEGWGELIHLLESG
AKEGKVKIKGIKGCVLVEDYVIIGQKLRNAENPECNRKVVPETARNTVTEMHEGCLGGHF
SAKKMLRQLSKRFFWPKIIVTMEKCVKGCPKCICTNDHPKLTAPLKPYETSRPLEIVAID
LIDVGLSVQGNRYILSIIDLFTKYGAAIPIPDNKAETVVKAFIDRWALGEGRIPEVLLSD
QGKEFINSHFEQFVKMLNIKHITTKGYNSRTNGRVERFNKTIMQILKKKTAVPMEWDEQI
PFAVFAYNSVAHKTTGELPMFLMYGRDSKHPIHMEGEDAFSGARLTILAGRQ
Download sequence
Identical sequences CJA03079 281687.CJA03079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]