SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03129 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03129
Domain Number 1 Region: 747-1144
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.89e-28
Family Reverse transcriptase 0.015
Further Details:      
 
Domain Number 2 Region: 1475-1643
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.02e-21
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03129   Protein: JA34220   Gene: WBGene00122333
Sequence length 2585
Comment JA34220 WBGene00122333 status:Predicted
Sequence
MLRVSLGLTTKAYNKLEQESKEAEELLKDIEFWSPQEIKDDEDMIFTKINIIHSKISVLE
SAMGKLASEAEKLDPNNDTDKQKFEAHADRVVEALSRGMRVRDLLKAQRDRAQLLKPGSE
QSEQAVQGIETTAKAPVLKIPRFEGDRWQWTNFWTIFDEIINKTTMSSLLKFNHLVNHLD
GAAKELVGRYRISGENYEDAVALLKARYDDTEATVVELHRKLRNSKTTGSTISEQRKLWD
RINVILQQLDNLGENLENRLIKDSIIEKFEYKVREGIFERKLNLENPDLWTMGKLQKDIE
ETITKRELLYQNLNSRNEENKIKHNHLDDASKKKGIRPISKWKCWYCGDDHPAAKCNVVT
DPKERSRILDEKKVCKICYRTSHTTAECQNDDLFCRKCKNNRHNPSLCFRKNESATSKMA
YNRKDGKTKHSNAVNINEEIDERETEEEYEEEQEDASGDEETRVTASATRKSAYLATIEF
EVYNNELKMWETTSIMFDSGSDQTYVSKKLEKQLSLPNMGKEKVLLQTFGEQPKEKEYTK
TKVAVRVGNEILEMHALASEELAGKMSKAMMTKEDLLFALQHNINFNKDVFKQKVNPQMI
LGTDYLPKIWRGNMVELPSGLWLLETPFGYTTMGKSKNVITSSNSREKEKNVSLSIRKLT
NEELEARKREDQQKLDTVMKMNEEFSGSLADEKDQMEAQTMKFFKETIEKRSDGYCVRLP
FKKFTDPIPDNYAIALKRLESVIKYQSNEVLEMIDDIFKDQLDKGIIEVVDMNEKGKGLI
HYNPHQPVLTPHKSTTKCREVIDGSSHFKNQPSLNDSIYPGPVILPDLCEMLVRFRAGKI
VILSDVEKAFLQVRLHEDDRDATRLLWIKDIRKLATKDNIIIFRFTRVLFGLNVSPFLLA
ATIQHHLESHPNQKLAKEMALNLYVDNLMLTSDEKPDKAINLYYEAKKTFLEMNMNLREF
LSNSKDFNEKVDHKDRAPDANMKVLGIRWFSIPDEIEAAVEKEELIKISRRTVASRLAGI
YDPCGTMVPLLLPLKLVQRKLWDDQYGWDTPVKEELTKEVRQILEAMEGFKIQLPRMVIN
KSGNNRLVTFTDASKEATACCVYVIREGHAALVMAKSKVRPLKEKWTTPKLEMQALTMGV
KLTKKVRRALFDGEILIDSAILLSDSEIALQWLKSDPTKKEVGVLISNRLDIIRRTVQEM
KEQYSTELLFGHVDTKQNPADLGTRGIDKNSFKDCIWWKGPSFLTNPIEKWPKFTSIFSL
PVTVEEHVICLSQTTELARRDPVQIFDCTRTNSFPCMKRITARVLKFIAKLAAKSMKTEQ
LARLEEAIPELRKIEEKGFLTAQEIQAGETILIKDQQKMISDKNIKQMVNLQLIKNENGI
IVCKGRMGNAELPQETKEPILLLPSFNICKMIIHDAHGKWHKSLDHTMIEVRRRFWIPRL
RQMTKNVISKCVPCQRMIKQPFKYPSMMAIPSYRITVNSPFEKTGLDYFGPIAYKLKDGT
VGKAHGCIFTCTVTRLIHVEIVTDETTKSFIQAFRRFISLRQLPKRVISDNAPTFVLGNK
IINEALTENSLSKEVQEFLGIQGITWTFITPYAPWKGGFYERMVRSVKTAFIKGIRTNTL
DLDELATCFAEITESINSRPLTYVENDLNSIEVLRPVDFIYQKIHTTLPLKDILENTDEY
RPSREAVSELTRTETIEALRTSINATEKVWTIWKEIYLAEIRETHKTRMDKKRGTPLTPK
ENQMVLIQDNDQPRNYWRMGRIVKTIPSEDGEIREVHVLVKPKSHPARVIVRPPNLIVPM
ELAENDPKNETEPEHEEKDMVIELPEANDKHTAHRYNLRTRKPVNYAADQKTSCLSTLKT
LTMISMIIMTILCSSGVQSATINEIECTKTGVRINTYYETFEVCAQDYCSSRTRMKWTRE
GPVDIWLPLAIKTSLHSVTTKLYDGKTVQIREMVCKGETTCEAIACTFCFQNIANPECSP
YWAWIGLGGILYFVALVIYCCLQVKIPLGGPLKMVGKLIWIMIKSSCRILRGQTQTQFAK
WPVKAAVGLVILGNLTVKTYGCQHVDTIHQEQAECVINNKIENCTIITEEFLKLNQIHKE
ACLRLTRNGTMFKEIRVEFLEAQLKCSKESITFTKEVELKTWSTKRCPHMGSCKDDKCLS
IGVNSMIPELVATSQYVGTTGCVESCSGPGCDCFFPSSACLFYRIYAIPQSNTTFEIFKC
LEWDKIIKVKVSITNMNSKNNQVAQVKTDLPINQPTKIETTTVTAEYISTPPSSILDTWF
IRNGTSIALWDKRFFPAFQCPSNTKAAHNKCQLAANCDCTPAESEMRCACNDINLQSLFR
NVERILPTHKGHWKIERHEDTVIATISEEVSTEVAVSIREKAEITIVKEVDICTIASAHT
VGCYSCAAGSYAKITCFSEKGQITANVICGNKMYAVPCSPQGNKIKLKFFSNIAQFHQKC
SVECGQESKNFEISGILKYTGSIWTSMYRMLEGNTTIYNEINLPDFSHIADGFLTFMKTG
IIILGIVAIIFLMTYMTIFSCWTSITKKLFCIIIGLPFFVVRKMFNFFWERQKRSRRHKP
HRHIV
Download sequence
Identical sequences 281687.CJA03129 CJA03129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]