SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03334 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03334
Domain Number 1 Region: 26-163
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.4e-41
Family APC10-like 0.0000202
Further Details:      
 
Weak hits

Sequence:  CJA03334
Domain Number - Region: 165-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.044
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03334   Protein: JA33325   Gene: WBGene00122538
Sequence length 224
Comment JA33325 WBGene00122538 status:Predicted
Sequence
MLQSDETKKSEGSSGWIPFVPRNLHPKDKPLLDISTQAVWTISSCKSGYGVDELLSDNVE
KYWQSDGPQPHTILLEFQKKTDIAFVMLYMDFKNDESYTPSKIQVKMGSSHQDVFFRVTQ
TFIEPQGWAYIDLRDKDQKPQRVFWVQIQVIQNHQNGRDTHIRCAIGCTCSGSQFVSAIY
VRTRPSSGPGKIASELHESHFHWRATRKYSTSTTHQSLGHLTLR
Download sequence
Identical sequences 281687.CJA03334 CJA03334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]