SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03440 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03440
Domain Number 1 Region: 242-395
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.77e-35
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 97-188
Classification Level Classification E-value
Superfamily Acid proteases 4.13e-16
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  CJA03440
Domain Number - Region: 37-74
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0014
Family Retrovirus zinc finger-like domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03440   Protein: JA26582   Gene: WBGene00122644
Sequence length 454
Comment JA26582 WBGene00122644 status:Predicted
Sequence
MRFVQIKQQTKIVATSKQNPQTPVEVWKLEASKTKRRENPKFTPKWGSKDRRPPFCDYCK
RAGHHISKCFLKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMITII
NSESWNMIGRPPLERVEHHISCANGSEMRVLGRARVTFALKGSEYKGYVYVREKNTNLIG
MSWLSQSPLMRKAMDVMVNQIEIPSAGIARLKDNPTVRSGNYQQNTKRTRITPSKPCPDT
KKPWAHIYVDFAGPINGFWFLVVEDSKTKYAEVKLTRKASAAATVNLIEEIFATHGYPDW
IVSDNGTQLSSHLFKKMCESHGITHKTTATYCPRSNGAAERFADILKRGIAKIKGSASIN
QRVLNNFLINYRNTPHAALNGATPAECHFSRKIRTTRSSPMLAERASENTEWIHYPSKMK
GAYGKRNGAXXXXSEHFPSFLPVFCHFFRFSTVL
Download sequence
Identical sequences CJA03440 281687.CJA03440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]