SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03667 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03667
Domain Number 1 Region: 1618-2040
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.81e-136
Family Reverse transcriptase 0.0000196
Further Details:      
 
Domain Number 2 Region: 2185-2338
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.16e-34
Family Retroviral integrase, catalytic domain 0.0035
Further Details:      
 
Domain Number 3 Region: 1327-1424
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000695
Family Retroviral protease (retropepsin) 0.04
Further Details:      
 
Domain Number 4 Region: 1013-1083
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.00000602
Family Glycoprotein B-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03667   Protein: JA32548   Gene: WBGene00122871
Sequence length 2482
Comment JA32548 WBGene00122871 status:Predicted
Sequence
MREKHLKLKKISVQMEREEISLETERPRVSKCAPAQLPTKYKKRKPKPPARSLADELAEA
DDQAPARPSAESSNPPTPPKDATDEDLRKWIQQIPEKRTFSKSITNLLSVLTRLRKSSTS
PDLEKEGMAKGDNQTPGRKSARNTRGENSPDQEKDTPKEEPTWEEEYGSGGKIEVPQGAL
WRSTSDIIKLLRETTKNFSEGSAANLVDWLHDFARSLYRINVPSGTGVSLLPFFLRHPAL
GKYNSLEERDKVDWKATTEALIKLHQCSSDRQLAAQEITALRQGKMSVSEFAEKLRKLGR
YAYEYLGKEARDRLTATHLLNGVSKDIRVELRRLPTTPETLKEMKHQAERIEKTLALEAE
EEEEEALIAAIKVQFPDQTRQWSQQGGRRQWQDRGVPLQFQHLPMQQGSCPHQCSSVPVQ
YPYPGNYNNQQWYGRNHGPYQSQDPRRQPGPAPQPAIEAPPPQHQGQTRGQRPGVNSVSK
FLLLVVALSLLPTTAPLQICGFGRTGNSFVAPSPIACTGTSDVPLQRHEANIYTARPEAL
ELEAFKCIRTLIHVRKFSFLTIYSTIEKIIVDQTTSIPVEECRKASQLRSYQGHELKEVA
PGLFRTEAVGNWTDQQHWFGTKEENIFELTMQRGTIASTDGNNIISELGSMEQCAIHSGH
CQDEESTTVWEKHSVQRECPFQYSMATEAIMSPDFVAIPALDIFSAIDKDVRKLHNIMEE
CHFNNAILTDDGLLIELPTLLYQRPRHTAFWLRTKRELATISGGANHQPISVDIRQNFSV
PLIFKLYKKRDIMECPIVHQNIADPMLLREFKRFNVTKTMLERRTRLYPEDRNHPRNYLL
IALKSIRIAQYSWREKRRLTEQKRDLTEGEMALLRLINEQDVFIFDKLLAREFGESTPDI
VNQDHRFPLPTFDEKRMAQERLEPYMEPSWSARPPPPPIFTTTTTEAAPYRPPPPTRPPP
ATSTTTTSRPTTSAPTMPRPTTSVPNITTEKPAEQDDKKQESKKTIEESFRNACKNQYVS
TSLFETILAIDPTAAVHQLLKRRDISAKRIGDSILVSKCRPVVQATMHWDRKVNNICYDL
VPVTVEDVLWFQLPGSEDLVAEAVVIPCHERQPIIHREGSKWIGMNNREVNPQRLGRPFR
RTQTQYLLDPPRTFYTTLEEETGVSTGSDKENERRFDRYQRNLEHTLETNGILHDGWNMI
RNATQNLHKSAKEIYHNTIDAISKGARKVFFSILQLLIWISIPLLIILLCIGFVYGYTKY
MAFRKMTRLAGRAARTATDELLERTLARINNVELRDDIPAHPQLARSFDQEYPLMGINTL
RINHIQAARIPHIDVILEGKKLEALFDTGAGVTYAPISSISTKLNTSVQPTAVAANGSTI
QFLGTTKSTINIGNLQVKHDILVSKDSDCPAPMLIGTDVMEKINKIGHNVSINLHKKQIF
IGSSMIPINAISGIEERMEVFPMEDVTIESRSEAVIPAVIKNYNCAMGPELLIEDTTQDN
GIDIFTVARAIVNASENGKTLVQIFNPTATPIVIPSNKPIAWASQVAEIKSLGQEIPPEA
HWEARLPDMPQEVPKNFKISDLVNLSDSNLTRKEKILLLEIIDRHPNAFVGKDGILGEYT
GTIKHRIDLVDGATPRVQKMYRIPLEKRDETERQIQMMLEQRIIRPSTSPFSALIVLVRK
ADKKSWRFTVDFRALNAITTPVQSVIPNIQDILDLCGGQEFYTSFDFQSGFHQILVEPEH
SPRTAFACHLGAFEYIRMPMGLKGAPGTFQRCMNELIKDVQARIFVYIDDLIITSATSSQ
HLQDIDEVLGRIEGIGMKLKAEKSKFAMKEITYLGFLVSKEGIRADPEKTRAVAEFPQPK
NTKDVRAFIGMASYYRRFVQNFAKIATPLHDLTKKEVKFEWTKERKEAFQKLKDALVSDQ
VLAAPKLGMQFHIEVDSSGKGVGAVLSQAQDESKPSDRRVIAFASRTYTGYERNYSALEL
EALGLVFAVQTFRPYIDGAKTIVITDHAPLKSMLYRKALTGRLARFQMVIQDYDIEIVYR
PGKENQVADTLSRYHPVKINALESVLKLDLKRILEEQENDDRIKETRNLVKTHLIQDGIV
FTLKGNDEWVICLPPESKYGRVLAKMVHESIFESAHLGRDKTEERVRSLACWKGMRKDIQ
LVVEKCAQCQKNKDSAKTKIRAPLGRFATPTSPFDRVHADFVGPLERTKRGNIYILFVDA
FSKFIIAEATRDQKASTLSSIFLDRVVSRFGPPNQLVTDRGTNFLSQEFKEVLQSLNIDH
NMSTAYHHEANGQVERANQTIEGMMRQVKDNEEWDTRLQTLVHAYNTAQNATTGVAPHCV
MHGQNARTPLKNTLPKTKTSITPREHVETLEKVKKQLHETCSKKIEEKTTHQKEKYDQNK
PINNPTIKIEDRVLIRKTKKNKTGPQFDGPYTVKEVEEPNITVTLGGPRTRITGERTRIV
HKNRCKLVHQKVTQEEEDSSPQ
Download sequence
Identical sequences CJA03667 281687.CJA03667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]