SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03684 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03684
Domain Number 1 Region: 16-195
Classification Level Classification E-value
Superfamily EF-hand 3.19e-46
Family Calmodulin-like 0.000000967
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03684   Protein: JA27895   Gene: WBGene00122888
Sequence length 199
Comment JA27895 WBGene00122888 locus:Cjp-ncs-3 status:Predicted
Sequence
MGKSQSKVPSKKKANKKLTTEETLQLEHTTYFSRQELKKWYKDFVRDCPSGQLRMEEFQG
IYRQFFPNGNPSKFAAFVFNVFDGNHDGYISFGEFITALSITSRGTLDEKLDWAFSLYDV
DKDGYITKDEMADIVEAIYSMIGNMLELPTDEDTPQKRVEKIFTNMDINLDGKLTREEFK
EGSKADPWIVQALTMDMST
Download sequence
Identical sequences CJA03684 281687.CJA03684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]