SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA03783 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03783
Domain Number 1 Region: 474-742
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.33e-79
Family Reverse transcriptase 0.0003
Further Details:      
 
Domain Number 2 Region: 934-1087
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.04e-34
Family Retroviral integrase, catalytic domain 0.01
Further Details:      
 
Domain Number 3 Region: 332-370
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000785
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 
Weak hits

Sequence:  CJA03783
Domain Number - Region: 1508-1560
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0513
Family G proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03783   Protein: JA34766   Gene: WBGene00122987
Sequence length 1692
Comment JA34766 WBGene00122987 status:Predicted
Sequence
MTALAGQANRRSASLNNFEHAMDQLRQRISVLEQQQAVMESQLVSSKKGMVSPSTCLSEG
GGTGASAGDAATSGGNTEKDVVNTNPTSNENNNYTDESVNQDSDQGINDVQQSADDEVRV
PRVNVLGFKSTTPIGTYSGAFSESLTLFVRQFRDQMRAADAEASDAAQINAFLTVLVGNA
RDRAEVFLNTNPTANVDQLVADLKAAFENELTGKLKEAQFTRCRQERGESIETYFNRVRL
LAAQAFHAENREVIERRARDAFLNGLDDGIRYNVKDKDPRTCKEAFDEAIRQDILRDDRL
ASQQYAPTVALLDEMRSLKQEWKNSQNKSNKDRRDRFGNQDNKDKEKRRWFHCNNVGHFI
RDCRKRLAGEPKAQQPNMEAVRNHHQRAPQVNAAVTEDLQAQLEVYRQQVAELQRLNGAL
MADSGIHGVRSLAWPSASNEVRKKNSTKSQFKIIFHFPESTVFSRKLAGQSSSRHWTWRT
VLAGMEQDVMMYIDDVLVFSKSFESHVKTLRKVLTRFREYNLKASPAKCEFAKKSIVFLG
HEISETNYSPNQANLDAIEKMPIPRDLRAVHRFVGMAGFFRKFIKHFSEIAEPLTKLTRK
EQQFEWTREQQQAFEILKGKLTSKPILAYPDYTKEFHIYTDASAVAQGAVLAQVSANEGN
IQVVAYGSRTLSEVETCRPAIQIELGAIVFALRHFKPYIWLSKIILHTDHRPLVHILAKS
KVNERIARWLIEIQQYDITIVHIDGKKNTVADCISRAKDEVAPLPTEELEDIIEFPVCMA
IDRSKDRVPKSFTPGNTQKPVDLALEQDKDSDVNIIKTFLTSPATTIDGISEKWLPFLER
VRMSETGILTVTFGNDNPKVVIPHTLQKLMFESFHTSLLGGGHFDWRKTLHKAQKKYFWP
GMRADFLKWTLECLKCQQKRNPHPSKREPQLVVVTSQVFEKVGIDLTGPLRTSVKSNKYY
INMICWFSKFVISVPLPDATCETISRAVLKELVLKFGTPNQIVSDNASSFTSAAFQQFCS
LLEIGHHRAIPHHSKGNGATERTFRTFHAVISKYINKEHSDWDTILPFTTFSYNNTVHST
TGETPFFLVFGRDPTLTIDRIIDPAPATKKTDIGWFKESLTTTLREVWKQAATRSREAQA
TYQNKANERANGSDIRPGDRVMYKNFSTHKGLSRKLILPWRGDFRVVEVDAPKATIYDRQ
HPMKPEKVVHLDQIKKIYEAEDERKMTDDKESDDEMFDENQETSDKSGNFETDRRMTSDE
VNNKAKLTQKAEKNKKSRQIEENRLPNMAPAKETTAATMDEKETKNARRNPQREKKAPAR
VRAKMEKSEPTPMAEETSLDDMVAPPAAEDVVDKVEDSAITPDDVEMADDRDGSTDSDEP
AALSSGLRSRTAAGSDGLPVAEDTETPIEINPKLLKENKITDSENPLLADAEMLDNSFED
MPPVDEETEKEYPDLWSKGTAVQLELPNDDGFRAVVSMTGFKQRTVCLRVRLFTPTTDLK
VVETLVINQKELGNSNGAQGREYDYVFVLTSRTSGNQGFLDDSKRINVALSRTKIACIVL
DERGFILHNVEKIPRALHEGHVDPYRIRYVSILPRIHAPSIYIPSSPTPAWIHGDRRQNN
PRSLHGGAWIYIGSYMDPIHVPSVSDPFWHYLPPPVTKGRRSGRSRGGEEGFWTGLPQGR
TLPHQNCPEAEP
Download sequence
Identical sequences CJA03783 281687.CJA03783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]