SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA03790 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA03790
Domain Number 1 Region: 627-811,904-1045
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.22e-46
Family DNA polymerase I 0.0077
Further Details:      
 
Domain Number 2 Region: 110-336
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000000000679
Family DnaQ-like 3'-5' exonuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA03790   Protein: JA19943   Gene: WBGene00122994
Sequence length 1079
Comment JA19943 WBGene00122994 status:Predicted
Sequence
MRCLKVYPFPLHELRRQISTSKRRLFERKVIETVCPRLHSYVFPNMPTPSTSSQKTYIGE
LPPLEANDVVEHFRVLAQNQTGKYRKLLEKAGEFDLELAKKVLERIDKNEQWLFETGWTR
YPFNPDDKIEKIDFPSDEILFFDIELVVQDGNLPTLAIALGGNAWYGWCSDRLINKTEIP
DFPTENDLIPIGEIWAEKIVIGHNVGFDRARVKEAYRIEDAKIRYMDTMSMALPMYGMAD
HQQSLYEMYDVEDTDTNNEWVNAWKGRVSKNSLVAVHDHLYPDKETNAESFSKKTLRASF
VKDPIEKIREDFQILMSYCARDNILCAEIYVRLWPEFTRRFPHPATLYGMLNMGNVYLPI
NSYWKQFYEKNVQMCEEKKTRATRSIVETARLLAGGRNLEEEEKGNEEEEQKASDVWMWS
QDWSYNGKLGSTEWLIKLFKSRAHVNLPIENVESHHIALKSHLIPAIFGFCYGPFPLFKT
RSKGWGFLVPNWKLLETFLKDHPKIEHIDAKTDFTADPSLKEFPHRKFFDTVKNNEYMFG
ELPISPDRKGFELDSNGLVRFYQLDHPSGEGNVGDPLTKHFAKDLKEQVLRPTRYEEQFA
VVLDSLQTTQFWTSYSQRYENEVTIWQPQSTRKTGNNLEMMDGAIAAAVVPAGTVSRRSV
HKLWVTLTNQSTGGVIGTGIKAMVQAPSGYRLVGADVDSQEQWLAALYGDASAEKRLPIE
KRVAGKTAFSNMMLAGSKSDNTDLHSVVANQLKISRNHAKTLNYARLYGSGETHAVSGKH
LMRIGGMKQAEAESTASQLFKLTKGEGARYMRVDSRMNVLVDMYLKTVENLDQCKVLAID
GFYYMPSYTSQFASETLEFEEWLLSNYSSLLNGHSSDSLISSIYENTTESLRLFVGGYES
STFNFLEISAAARDLRTPILGCQIADSLGKLPTGTPGSTSFERKYKRSVMNWIVQSSAVD
FLHLLLVSMHWLCEKYNIPARFSISIHDEVRYLCPEKDAPRLALALQFSNLLVRAYISQR
VGICQLPNTVAFFSQVDCDTVLRKEVDTVSINPDGTKIADGVAWTIEDLLKLTDGKFSK
Download sequence
Identical sequences 281687.CJA03790 CJA03790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]