SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA04219 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA04219
Domain Number 1 Region: 460-632
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.78e-38
Family Reverse transcriptase 0.0013
Further Details:      
 
Domain Number 2 Region: 330-421
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000894
Family Retroviral protease (retropepsin) 0.014
Further Details:      
 
Domain Number 3 Region: 268-313
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000419
Family Retrovirus zinc finger-like domains 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04219   Protein: JA21901   Gene: WBGene00123423
Sequence length 637
Comment JA21901 WBGene00123423 status:Predicted
Sequence
MDSSALKLFLTQQQEAHKEQLVFLQQQQEKLLETILKKIGTQTDHTSILNSLNGRIATFK
YNSEDGETFDRWFGRYEDVIKVDGAQLDDASKTRLLVTKLDKNEAEQFRNHILPKMPAEV
NFEDTVAMLKKLFNETKSLTRLRYELLSVKFDGNDRKIYTGLVKSRFSVAQWSTMTEDQA
QCLLWIMGLKSHEHAELRARALRELEQDSRITLTELTDRLDQVIALRNDADFMEGPASSV
NAVNYNKAKQQPQSSRKPSQAHSKSNNSCQPPKTPCYKCGQMHWARDCKLASNTVCRNCN
KNGHLAKVCKSKRSTNNAIFIAQSSAQNRNLIYYNVEIEGKQIKMQLDTGAEVTLMNAKD
WMRLNKPKLSHSTINLRTANNEPIKVKGQFKCNFNLNGHHGSGLCHVTDTASLLGLDWIA
QDTTLYQHLIQASVNSISNAIPEASSACRKKLELGLRSTFPDVFESGLGRCSKAKASLQL
KPNASPTFRKARPVPYAVLPMVTQELNRLVKQGVYTATDYSDFATPIVVVDKKDGSIRLC
GDYSTGLNDSLDSHQHPLPTAKDIFSTLNGGKYFTQIDLSEAYLQIEVDEDSKKMLTINT
HLGLFYPNRLPYGVKSAPAIFQQIVDTMISGLEGVAA
Download sequence
Identical sequences 281687.CJA04219 CJA04219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]