SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA04679 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA04679
Domain Number 1 Region: 559-744
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 3.53e-28
Family Lambda integrase-like, catalytic core 0.01
Further Details:      
 
Domain Number 2 Region: 216-388
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.78e-27
Family Reverse transcriptase 0.0037
Further Details:      
 
Domain Number 3 Region: 184-221
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000023
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04679   Protein: JA24710   Gene: WBGene00123882
Sequence length 768
Comment JA24710 WBGene00123882 status:Predicted
Sequence
MEDVEKTGDQSSLVLKLAEMQSNMMEKMQNVMKSLENQEKPREEEKAPKVTQKGIQKNID
FNTKLRNILLGAVGTTALEEKVNQALDLLAKRNSELVMLDTAPEMLKAKEKFEALRAMSA
TTGAQGQDTDWTPLLVLSQMQSMHQSSAETNTKRRRTEQEPSNRWFRSEGTFRGNGGARF
SGSQHTFKPRQAEKKSSKCFNCHRYGHFATECNQRRSGYHHIKIHKDSQDLLAFSLSDPP
AKPYYVFNALPFGLCTAPWIFTKLFKPLIRKWRSEGIKIFLYLDDGLILAETKEEAERVV
ERVRKDLKNAGVCVAEDKSFWVPETRFRWLGYECDLITREVRGTEKRMEKLCVALNMLRG
SVAPTILDRMKFLGGLASLSIVSGDSGVARSRNLMQAVAESQKAGENENKKKNKTKEKLN
PERVESTSSNTYQERHPLDYLGGQKRDFLLKMMKTSDTEDKKLIDSLALVPYNSKAMSTT
KAYKLANEKRVEWALTKKLTSPEESLLLYMAEKAKTVGSSALATISAAYQAANETCSSIC
QAFVTDLIKATRRKETEKKKEVVEVEIQDIEKIVKLALDSNEPSLDRDALIAVLSFKAML
RASEAANLEWSDVRMEQNMIEVKIKRAKNDQMALGRLSFFEYEAGSDEDILMCRWRLRKR
GNCQHVFSTLHGAEPLSAASISSLASKMLSKIGKFGATHHCFRRSGANYLQSQGFSFEEI
QKRGRWRSQAGLQRYLKDSPRAQGCLPKPMLEPYEQLPTSSTTQALPS
Download sequence
Identical sequences 281687.CJA04679 CJA04679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]