SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA04779 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA04779
Domain Number 1 Region: 91-195
Classification Level Classification E-value
Superfamily Second domain of FERM 4.97e-31
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 2 Region: 23-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000517
Family First domain of FERM 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04779   Protein: JA21054   Gene: WBGene00123983
Sequence length 489
Comment JA21054 WBGene00123983 locus:Cjp-frm-4 status:Partially_confirmed
Sequence
MQRNTTQQRSFVFLYLARENSENRTQSAQTVLDYVCELKRIQEKDFLGLRYQDHNKHRYW
LDLSRSIGHVVKHFRTDTMTLHLRFRYYPSDPARLSDPNLRYQLFVQLQRDLLHGRLYCP
ATSAAELAALILQAQLGDYDETKHVGNYVSEYKLLLKQTPKLEERIASIHKELHGKSSVD
AELEFLEKASQLDTYAFDPYTIKLIAQCTYSKLLNNRICGPTLRTATSDATNRATMAQQT
EEQSYATSTFSTASTPIDESYNNNLRKITNLNISLDNSSTPSSSSPVDIQEPPKIIRTFE
HAEQNSTSFTVHLIKREEIVTPTTPTTSSCHQETRAEHLEHKFNKLVENDVDIGRPLASS
TPRANKQTPNLEKIENGTVGNGQGVVEKKTSNGHAIQRTEEVQDSLISDKSEISPKTSFV
SKAANTLFVLFLMLLLTLALIIVLFEKSEGSHRDFIESNRHLSDLRHHYYEPSRHYVVAQ
YHKYFGAKL
Download sequence
Identical sequences CJA04779 281687.CJA04779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]