SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA04930 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA04930
Domain Number 1 Region: 309-736
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.89e-32
Family Reverse transcriptase 0.016
Further Details:      
 
Domain Number 2 Region: 1057-1228
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.84e-19
Family Retroviral integrase, catalytic domain 0.024
Further Details:      
 
Weak hits

Sequence:  CJA04930
Domain Number - Region: 13-74
Classification Level Classification E-value
Superfamily Acid proteases 0.00013
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA04930   Protein: JA20880   Gene: WBGene00124134
Sequence length 1435
Comment JA20880 WBGene00124134 status:Predicted
Sequence
MPFMPLSTTTGNILLALVDTGATTSIISEVTAKKLGLQIVKKQLMSFKGLISSSEQQWYN
FYQLKVTDSKHRLWAASIPGYTKLPTIFRSPILSLEDQMYMKNHGLDVKLITRLSRYDGQ
PIDLLLGNNVISHLVKDSRRFILPSGRLIEQTPLGLITYPTPIPNVLSTDENVSYLDTSS
YHQEEHIYTVDSIDFASPEDDILVIPTSPNNQPQQISNAMLDKQLAQMWNLDVLGILPPE
AMQQKTLIDEELIDQFKKNATTDKDNKVYVAFPLNGREKDLFHNYPVAARRLTTLLNNQL
RTGTTRMQYHDIIMSQLESGIIERVEDKSPTNEDGNSYFIPHRVVIKLESTTTKLRIVLD
ASSHMKNELSLNDCVFPGPSILQSILGILLRSRLKKYLMISDIEKAFHQVRIQPQYRNLT
KFLWLKDPALGYNPDNIAIYRFTRLPFGVACSPFLLAITILRYLEQNPDEINQRVTENLY
VDNILFTTNKIEELKKLYEDSKNAFNKMHMNLREFMINCIEVMEQIPEKDRANNHITKLL
GHIWNAELDTLTIKIAQPPDGIPTKRQLASFQAKTYDPTGMVCPILIPIKNLMHKLWIAG
TKWNEPLPTSLEKDWKKAKLLFDESELVLPRQLVNNYNYKTVSLIIFSDASKDHYGLAAY
LRYDFGQDVYNCRLIFAKSKIRPAKTELTIPQMELLGVEIATNAAATILKELHMKIDSVT
FFCDNVSVLYWILHRTNGTRWVEHRVKKIRTTLGSINQDNLKTSLRYIPTDQNPADIATR
GCSVSELKASKIWFTGPQIMLQNQNTWPKKLDDTPADPHLFHDFSQGKEPRSLTRIRPAT
NETTECLEILNISACHNLESIVPYACTNSLVKLSSIIHLTLQWITNAVKKRNERFPDDLI
QLQGRTLKQYQNAVINNNEVEKRVVARQYIIRAHYDDAAQRLHQYPPKEFKPMLDENEIY
RKTTNFANAPFPRDHREPIIILKKHPLAYLIAREVHMFTGHQGYKESLAEFQRRYASAAS
GQLIRHICSRCTICKKRHGRAYKYPFAKTIPRTRTEAMIPFAHIGIDYFGPIKYKTTNAE
TNQTGIGKMWVFLATCIVTRAVHLECVMDNSTRQFLLALRRFVARRGAPETILSDNAPTF
VLGLKMINTNVVEFVNQSRTLTNYLASKEIAVKQITPYSPWQGGIYERIVGIVKSCLYKI
IGPANLTFLELETIIIECEGMVNNRPITRNAIDASDSLAIRPSDFLMPSVQMSFPDEFSS
MRERVLKTIQMGTTEKLTRMYLHGLDRLLTELWNVFHQEYFSALQQRRPTTGHYCRIKPK
PGHIVHVKTNNLLPRNHWPLGRIMSLNKSQDQQVRSAVVKCGKELLERPINQLVPLECPE
LNDNASLDELQQLATIPQPTVPPILFNENSERTASTTSHFSTTSPQPMHFSQQLQ
Download sequence
Identical sequences CJA04930 281687.CJA04930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]