SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA05237 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05237
Domain Number 1 Region: 297-348
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.000000000000235
Family Eferin C-derminal domain-like 0.0023
Further Details:      
 
Weak hits

Sequence:  CJA05237
Domain Number - Region: 187-277
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0206
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 69-243
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0811
Family Outer membrane efflux proteins (OEP) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05237   Protein: JA22829   Gene: WBGene00124441
Sequence length 410
Comment JA22829 WBGene00124441 status:Partially_confirmed
Sequence
MTTEFVSEEESKYADSPMRLQGSSASSASVASRLYGTRSRRDSLGGSSSESDLIAFGGDQ
DALSDFSSQMNQLNSFTKRYSELEERNMSLSDERTRLKTENSVLKERMHNLEEQLTDNED
RFKQLLNDEKTRGNELISRLKREKELETESWNLKYQMLEKDLTSAKRDIERANEETKRAK
NDYEKMSNKLEEAQLLIEGMEEERIQLERQFKKYKEEAQQDIDSSSEMVEVLTMETEELR
RKFDGPRSGSISDHIGDMNDELETLRAKVAELLSEKEEMSDQLLATSVERGRSLIADTPS
LADELAGGDSSQWLEALREQEICNQKLRVYINGILMRVIERHPEILEIAEEGVRPFSKLT
VRRRISVIAVKLNVVICRTGRVHVTNSFRSNFRLSSLLFLEMGMMMMMTS
Download sequence
Identical sequences CJA05237 281687.CJA05237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]