SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA05570 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05570
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily POZ domain 0.0000126
Family BTB/POZ domain 0.024
Further Details:      
 
Weak hits

Sequence:  CJA05570
Domain Number - Region: 321-396
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000146
Family Second domain of FERM 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05570   Protein: JA32400   Gene: WBGene00124774
Sequence length 403
Comment JA32400 WBGene00124774 locus:Cjp-frm-10 status:Partially_confirmed
Sequence
LLADNSTVLFDIFYTTNTEGTTTFEIFDFTYEAVLGMVSILQLDAFDITISNYRELLELG
FYYQLLPVLDKCEDFLLKTKKVSLDNKLKLSEMFRLHLLQCRTLEQIKSVEQVDKILDDN
IDLGDRTYEALLERLRYLERKESGKPMKCLCGRLHGKDDVKVKEQEQHAESLPYSPIQQA
LRTIHNQSTETSESPKPVNFRIYLTRMEYSAFTENGIDLSIESGKTANSKLLLFYLAREY
KIDKDVFTEMFAIWMISPLLEVQLKPYHRPYECRQGWKTLLNRFYDDKSEELFDQDEPIL
MLRRNASLSSERELEILSEYPQCADLLIIDAADMIFLGRLHFLSIDHTVCVAALLFSLQH
EKFDEDIHDVAFIRAHLEEILPERTCDSILAKRLFGKAINKKT
Download sequence
Identical sequences 281687.CJA05570 CJA05570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]