SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA05681 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA05681
Domain Number 1 Region: 357-552
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.67e-51
Family Reverse transcriptase 0.0009
Further Details:      
 
Domain Number 2 Region: 216-308
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000000000292
Family Retroviral protease (retropepsin) 0.0094
Further Details:      
 
Domain Number 3 Region: 146-191
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000924
Family Retrovirus zinc finger-like domains 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA05681   Protein: JA30829   Gene: WBGene00124885
Sequence length 553
Comment JA30829 WBGene00124885 status:Predicted
Sequence
MFEQRLVISKLDTKQYSHYANRILLRRRRQSTKDGKYFLRTEYHGSSIEEYTGTVLRRFA
SSDFKSMTDDQLCCMVWINGLRDPAHIDIRTRALQTMESRPDVTLLQLESEIKRLLDLRA
DSKCVAGSTPSHAAEINAIFRKQQRDNNREQGPPSACYRCGGPHWARDCNVKDVKCSKCG
KTNHMAKFCRFQDKTMPHQKKKVKSVIISLASSSGASRIYRKVFINSKPLRMQLDTGADI
TLINTKDWAKIGKPKLDKPSIKVKSATGQPINVKGSFTCDFTINGNSATGTAHVADTDTL
LGIDWISKDTQLWNLLQDNHQINAAFSVIGSACNYLDNTREKLKFDLKSEYPIIFQPGLG
KCTKTKASIRLKPGAQPVFRKARPVPYATLPTITEELDRFVQEGIATPIDHAQWAAPVVP
IRKKNGSLRMCADFSTGLNDAIESHQHPLPTADDIFATLNGGKHFSQIDLAEAYFQIELD
EDSKNLLCINTHRGLFQFNRLPFGVKPATAIFQQVMDSMISGIEGAAAYLDDIIISGGTV
EEHNSRVKAVMQX
Download sequence
Identical sequences CJA05681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]