SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA06038 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06038
Domain Number 1 Region: 30-103
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000026
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06038   Protein: JA35607   Gene: WBGene00125242
Sequence length 280
Comment JA35607 WBGene00125242 status:Predicted
Sequence
MEHNPKPPASPPEPDMTEEQRLTVKIRERADNVQACRVCWDEYHGARNPARLLSCGHSFC
TRCVVSCSNPEMQVNDDNDEIRCPECRRVSKQPPATFPVNFQLMQILTTLSLLRTPRSEE
EEEKELPSANFDTLGTILPVNKMKELSMTDLMHHGQVYFDALRHRANEDKPKSGVLLEIA
NTVMNRINELQRIMEDFVKSWDKIKKGQQPRQCWHLRSGMTVRRPHIQTMQEILDTSPIA
ARRILDPDFMRTNRSIFRVLRSFLPFFAFRAKPHNTILQN
Download sequence
Identical sequences CJA06038 281687.CJA06038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]